PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family GRAS
Protein Properties Length: 464aa    MW: 52191.9 Da    PI: 6.4098
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007890.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.88.3e-93864591373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl +A+a+++++++ a  +L ++ ++as +gd++qR++ayf+ AL+ r+ +  s ly+++ +s+t+    +ee++a++ f+ +sP+++f+h+ta
  Aco007890.1  86 LIHLLLFAATAINKNNTSSAVDALHEIYKNASFHGDSIQRVVAYFADALSVRIPSPRSPLYHSIVVSPTP----EEEFSAFTEFYRASPYYQFAHFTA 179
                  689******************************************************************8....7899999***************** PP

         GRAS  99 NqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlvakrled 188
                  NqaI+ea+e+e      r+H+iDfd+s+G+QWp+L+q+L++++  ++p slRiTg+g+    s +eleet+ rL +fA+ + ++ f+f+ +  +   +
  Aco007890.1 180 NQAIVEAFENEekrngGRIHVIDFDVSYGFQWPSLIQSLSDKAssSKPISLRITGFGR----SVDELEETEMRLVNFASGCnNLFFKFEGI-LRG--S 270
                  **********98888889**********************999745555*********....9***************987369******6.443..3 PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                   + +++r+++  +l+Vnlv+ l++l  +s ++    +++L ++ sl P +vv++e+e + +  sF+ rf+e+l+yy+a+fdsl++ lp+es er ++E
  Aco007890.1 271 STCNDIRIEKYSTLVVNLVFYLQKLS-SSNEM----HDTLATIHSLHPSLVVLIEREGNQSPRSFVSRFMESLHYYAAMFDSLNECLPPESVERLSIE 363
                  44699*******************97.44444....559*********************************************************** PP

         GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.............eesgslvlgWkdrpLvsvS 371
                  +  lgrei+    +e  e    h ++e+ ++r+e++GF++++ls+++++qaklll+  + +g ++              +e  ++ lgW++r L+++S
  Aco007890.1 364 KNHLGREIKCGMDQEDGE---GHFKVESLKQRMERVGFEEMKLSSRTVSQAKLLLKIKS-HGSTMGcgsncggfrvlvrDEGREISLGWQERLLITAS 457
                  *********998888887...99999999*************************98654.33333322222233333434466777************ PP

         GRAS 372 aW 373
                   W
  Aco007890.1 458 GW 459
                  ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.92860428IPR005202Transcription factor GRAS
PfamPF035142.8E-9086459IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MNEGAGEELL SLSLGLNSSW CTNTTKMKRK AKDDHEYSNP ACNVTTMQDV EDNKFFNLLH  60
MRDQMLKHDP KRSNGALEGT TNGLQLIHLL LFAATAINKN NTSSAVDALH EIYKNASFHG  120
DSIQRVVAYF ADALSVRIPS PRSPLYHSIV VSPTPEEEFS AFTEFYRASP YYQFAHFTAN  180
QAIVEAFENE EKRNGGRIHV IDFDVSYGFQ WPSLIQSLSD KASSSKPISL RITGFGRSVD  240
ELEETEMRLV NFASGCNNLF FKFEGILRGS STCNDIRIEK YSTLVVNLVF YLQKLSSSNE  300
MHDTLATIHS LHPSLVVLIE REGNQSPRSF VSRFMESLHY YAAMFDSLNE CLPPESVERL  360
SIEKNHLGRE IKCGMDQEDG EGHFKVESLK QRMERVGFEE MKLSSRTVSQ AKLLLKIKSH  420
GSTMGCGSNC GGFRVLVRDE GREISLGWQE RLLITASGWS CRE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3610545922374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6620871e-144KM662087.1 Ananas bracteatus clone 45421 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784262.10.0PREDICTED: scarecrow-like protein 3
TrEMBLM5VGL51e-171M5VGL5_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s11540.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116493038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.16e-56GRAS family protein